PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5705_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 305aa    MW: 33914.1 Da    PI: 8.8463
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5705_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.41e-38166242177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv+gCe dls+ak+yhr+h+vCe+hsk+p+v+vsg+e+rfCqqCsr h++sefD +krsCr+rL +hn+rrrk+q
  RrC5705_p1 166 RCQVDGCELDLSSAKDYHRKHRVCETHSKCPKVIVSGVERRFCQQCSRLHAVSEFDGKKRSCRKRLFHHNARRRKSQ 242
                 6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-33158228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.18164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-36165242IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDCNLRSPLV WDWENLIISN PSKTEHDKKH LTTTTTASEW EIESLFPCFD GLQRVSNDST  60
SFWHNTAVSK NSESISANSA SSSPITRQTK PASESSPCSN IDFVQVKTSS AALEVPAESS  120
DLCLKLGKPT YSGRDSNDAS AGSTKLLAPC RKKSKSCGQS SMQVPRCQVD GCELDLSSAK  180
DYHRKHRVCE THSKCPKVIV SGVERRFCQQ CSRLHAVSEF DGKKRSCRKR LFHHNARRRK  240
SQGVFPLNPE RVVYDQKFAW DVGEYSGVLH QSHRAFSLLS TSSGPLVHPH AQPLSLLFSF  300
DGLPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-25158240484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222239KKRSCRKRLFHHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013697209.11e-134PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_013697211.11e-134PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_013697212.11e-134PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ9FZK01e-101SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLA0A078DCB61e-134A0A078DCB6_BRANA; BnaC05g21270D protein
STRINGBra032822.1-P1e-121(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.41e-100squamosa promoter-like 11